SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163942685|ref|YP_001647569.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163942685|ref|YP_001647569.1|
Domain Number 1 Region: 1-111
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 7.33e-30
Family DNA-binding N-terminal domain of transcription activators 0.0000937
Further Details:      
 
Domain Number 2 Region: 154-240
Classification Level Classification E-value
Superfamily Antibiotic binding domain of TipA-like multidrug resistance regulators 6.67e-29
Family Antibiotic binding domain of TipA-like multidrug resistance regulators 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|163942685|ref|YP_001647569.1|
Sequence length 241
Comment MerR family transcriptional regulator [Bacillus weihenstephanensis KBAB4]
Sequence
MRVKEVANLVGISVRTLHHYDEIGLLTPDETTESGYRLYSNENLETLQQILFFKELGFPL
KKIKEIIMSPSFDHEEALQLHKKMLLEKRARLDKVIATINKTIQHTKGEIDMTNKEKFEG
FDFSHNPYEEEARERWGDEAVDKANKTAKGMSKEKQEEFNNIYRNLATLRNGAPDSKEAQ
SAIGVWYDYLQNFGEYSLEAFKGLGQMYVADERFTKNIDKFGEGLAQFMCDAMEVYADRK
K
Download sequence
Identical sequences A9VNX2
gi|163942685|ref|YP_001647569.1| 315730.BcerKBAB4_4791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]