SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163942819|ref|YP_001647703.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163942819|ref|YP_001647703.1|
Domain Number 1 Region: 138-428
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.4e-133
Family Enolase 0.00000000148
Further Details:      
 
Domain Number 2 Region: 3-138
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.36e-61
Family Enolase N-terminal domain-like 0.00000101
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|163942819|ref|YP_001647703.1|
Sequence length 431
Comment phosphopyruvate hydratase [Bacillus weihenstephanensis KBAB4]
Sequence
MSTIIDVYAREVLDSRGNPTVEVEVYTESGAFGRAIVPSGASTGEHEAVELRDGDKSRYL
GKGVLNAVNNVNEAIAPEIVGFDVTDQAGIDRAMIELDGTPNKGKLGANAILGVSMAVAH
AAADFVGLPLYRYLGGFNAKQLPTPMMNIINGGSHADNNVDFQEFMILPVGAPTFKESIR
MGAEVFHALKAVLHDKGLNTAVGDEGGFAPNLGSNREALEVIIEAIEKAGYKAGENVFLG
MDVASSEFYNKETGKYDLAGEGRTGLTSAEMVDFYEELCKDFPIISIEDGLDENDWDGHK
LLTERIGDKVQLVGDDLFVTNTQKLAEGIEKGISNSILIKVNQIGTLTETFEAIEMAKRA
GYTAVVSHRSGETEDATIADIAVATNAGQIKTGSMSRTDRIAKYNQLLRIEDELGEIAVY
DGIKSFYNIKR
Download sequence
Identical sequences A0A0D6T2N6 A0A0G8EWT0 A0A1A9PRC0 A0A1C4GGK7 A0A1K0AFD2 A0A242ZKQ6 A0A243A9T3 A0A243BY13 A0A243KHB4 A0A243MU07 A0A246PUR2 A0A2A8YAV7 A9VQ48 C2PMM1 C2Q369 C2YYV9 J7YBF9 J7Z7G1 J8HST8 J8Y6H8 J9A5U7 R8CPC9 R8HJI3
315730.BcerKBAB4_4927 WP_000103948.1.10033 WP_000103948.1.100649 WP_000103948.1.101140 WP_000103948.1.11324 WP_000103948.1.17265 WP_000103948.1.17940 WP_000103948.1.1809 WP_000103948.1.1907 WP_000103948.1.20643 WP_000103948.1.24182 WP_000103948.1.24338 WP_000103948.1.25572 WP_000103948.1.26450 WP_000103948.1.26847 WP_000103948.1.27140 WP_000103948.1.27732 WP_000103948.1.28299 WP_000103948.1.29766 WP_000103948.1.37384 WP_000103948.1.39538 WP_000103948.1.39896 WP_000103948.1.4039 WP_000103948.1.45835 WP_000103948.1.46349 WP_000103948.1.46524 WP_000103948.1.473 WP_000103948.1.47936 WP_000103948.1.47957 WP_000103948.1.50350 WP_000103948.1.50411 WP_000103948.1.50416 WP_000103948.1.51099 WP_000103948.1.51556 WP_000103948.1.52932 WP_000103948.1.54007 WP_000103948.1.56549 WP_000103948.1.59016 WP_000103948.1.61481 WP_000103948.1.64566 WP_000103948.1.64666 WP_000103948.1.68668 WP_000103948.1.69703 WP_000103948.1.6996 WP_000103948.1.74901 WP_000103948.1.79293 WP_000103948.1.81198 WP_000103948.1.82566 WP_000103948.1.8365 WP_000103948.1.85012 WP_000103948.1.87960 WP_000103948.1.8907 WP_000103948.1.89704 WP_000103948.1.90187 WP_000103948.1.93290 WP_000103948.1.93582 WP_000103948.1.99908 gi|163942819|ref|YP_001647703.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]