SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163942854|ref|YP_001647738.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163942854|ref|YP_001647738.1|
Domain Number 1 Region: 5-113
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 8.06e-27
Family DNA-binding N-terminal domain of transcription activators 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|163942854|ref|YP_001647738.1|
Sequence length 253
Comment MerR family transcriptional regulator [Bacillus weihenstephanensis KBAB4]
Sequence
MELISIQELTRETGVTVRTLRYYDQIDLLKPSGKTDGGHRLYSERDVVRLQQILFLKEMG
FSLKEAANMLVKGELNLKDSLEKQLRFVQEEQKKFNRMERVLQAVVYSVDVEGELDWKVM
FELIQLSKQSSRIREIFQNEVFSKGEQKLLHNLPNMSEEDPNVLEWVNLLKQLRNFMKDG
KEASCDEVQGATKKLMQKCLEMANGDEAFLDKLWEVRKSKEDSQKMSMYPIEEELLLYMD
EAFRIYDERERDK
Download sequence
Identical sequences A0A1C3TG79 A9VQ83
315730.BcerKBAB4_4962 gi|163942854|ref|YP_001647738.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]