SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163942871|ref|YP_001647755.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163942871|ref|YP_001647755.1|
Domain Number 1 Region: 3-324
Classification Level Classification E-value
Superfamily Release factor 3.66e-134
Family Release factor 0.000000042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|163942871|ref|YP_001647755.1|
Sequence length 326
Comment peptide chain release factor 2 [Bacillus weihenstephanensis KBAB4]
Sequence
MMGAGFWDDQQGAQAVINEANALKDMVGRFRQLDETFENLEMTHDLLKEEYDEDLHEELE
SEVKTLIQEMNEYELQLLLSDPYDKNNAILELHPGAGGTESQDWGSMLLRMYTRWAEKRR
FKVETVDYLPGDEAGIKSVTLLIKGHNAYGYLKAEKGVHRLVRISPFDSSGRRHTSFVSC
EVVPEFNDEVEIEVRTEDLKIDTYRASGAGGQHVNTTDSAVRITHLPTNTVVTCQSERSQ
IKNREHAMKMLKAKLYQKKLEEQQAQLDEIRGEQKEIGWGSQIRSYVFHPYSLVKDHRTN
TEVGNVQAVMDGEINPFIDAYLRSRI
Download sequence
Identical sequences A0A084IWK7 A0A150CGC9 A0A1I6BE22 A9VQA0 C2Q3C5 C2SSN6 C2Y1Q2 J7T7R9 J8HSM9 J8J6K3 J8LFC0 J8N3Y0 J8P872 J9BFF7 R8CSE3 R8EG19 R8HJC9 R8MIW4 W4DTL9
WP_002016130.1.10033 WP_002016130.1.100646 WP_002016130.1.100649 WP_002016130.1.17940 WP_002016130.1.20051 WP_002016130.1.20881 WP_002016130.1.21695 WP_002016130.1.27729 WP_002016130.1.27732 WP_002016130.1.28299 WP_002016130.1.2902 WP_002016130.1.2904 WP_002016130.1.30061 WP_002016130.1.31050 WP_002016130.1.35095 WP_002016130.1.36226 WP_002016130.1.37635 WP_002016130.1.37801 WP_002016130.1.38645 WP_002016130.1.39255 WP_002016130.1.39317 WP_002016130.1.4354 WP_002016130.1.4496 WP_002016130.1.45835 WP_002016130.1.46157 WP_002016130.1.47674 WP_002016130.1.50411 WP_002016130.1.52845 WP_002016130.1.54007 WP_002016130.1.57105 WP_002016130.1.59016 WP_002016130.1.60236 WP_002016130.1.63476 WP_002016130.1.6426 WP_002016130.1.68186 WP_002016130.1.72867 WP_002016130.1.75292 WP_002016130.1.76817 WP_002016130.1.79293 WP_002016130.1.82832 WP_002016130.1.8290 WP_002016130.1.85012 WP_002016130.1.85187 WP_002016130.1.86789 WP_002016130.1.87416 WP_002016130.1.99558 WP_002016130.1.99908 315730.BcerKBAB4_4980 gi|163942871|ref|YP_001647755.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]