SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163942892|ref|YP_001647776.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163942892|ref|YP_001647776.1|
Domain Number 1 Region: 1-101
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 1.7e-37
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|163942892|ref|YP_001647776.1|
Sequence length 107
Comment phosphotransferase system PTS lactose/cellobiose-specific IIA subunit [Bacillus weihenstephanensis KBAB4]
Sequence
MMTTAEQIPFQLILNSGNARSFAMEALQFAKQGKMAEADEAMVKAKEAINEAHHFQTELI
QSEARGEKTEISVLLIHAQDHLMNSITVKELAAEFIDLYKKLEAKGE
Download sequence
Identical sequences A0A0A0WVQ8 A0A150CGR7 A0A1H4EY32 A0A1I6BF78 A0A242X3E1 A0A243AA10 A0A2B4Z6Z3 A0A2I0RF30 A9VR52 C2Q3E9 C2SSQ8 C2VJG6 C2Y1T1 C2ZFC1 J7W7Q8 J7YRJ2 J7Z613 J8APE0 J8BN98 J8HK94 J8J123 J8N0S0 J8NJ27 J8PDK2 J8PZ99 J9AT39 J9BVG5 R8CN67 R8CSL2 R8EFU3 R8HEM1 R8HJG1 R8MI11 R8NP34 R8PZ42 W4DVR0
WP_000989054.1.100215 WP_000989054.1.10033 WP_000989054.1.100479 WP_000989054.1.100621 WP_000989054.1.100646 WP_000989054.1.100649 WP_000989054.1.100771 WP_000989054.1.11324 WP_000989054.1.11609 WP_000989054.1.13424 WP_000989054.1.16355 WP_000989054.1.17940 WP_000989054.1.20051 WP_000989054.1.20881 WP_000989054.1.21695 WP_000989054.1.22507 WP_000989054.1.23136 WP_000989054.1.2407 WP_000989054.1.27729 WP_000989054.1.27732 WP_000989054.1.28299 WP_000989054.1.2902 WP_000989054.1.2904 WP_000989054.1.30061 WP_000989054.1.31050 WP_000989054.1.35026 WP_000989054.1.36226 WP_000989054.1.37019 WP_000989054.1.37635 WP_000989054.1.37649 WP_000989054.1.37801 WP_000989054.1.38645 WP_000989054.1.39255 WP_000989054.1.39317 WP_000989054.1.39896 WP_000989054.1.42272 WP_000989054.1.42747 WP_000989054.1.42941 WP_000989054.1.4354 WP_000989054.1.4453 WP_000989054.1.4496 WP_000989054.1.45835 WP_000989054.1.46157 WP_000989054.1.474 WP_000989054.1.47674 WP_000989054.1.47957 WP_000989054.1.50411 WP_000989054.1.52845 WP_000989054.1.53672 WP_000989054.1.54007 WP_000989054.1.55893 WP_000989054.1.57105 WP_000989054.1.59016 WP_000989054.1.6 WP_000989054.1.60012 WP_000989054.1.60236 WP_000989054.1.61126 WP_000989054.1.63476 WP_000989054.1.6426 WP_000989054.1.64566 WP_000989054.1.65665 WP_000989054.1.66471 WP_000989054.1.68186 WP_000989054.1.68550 WP_000989054.1.68668 WP_000989054.1.6996 WP_000989054.1.70209 WP_000989054.1.72294 WP_000989054.1.72824 WP_000989054.1.72867 WP_000989054.1.73166 WP_000989054.1.73952 WP_000989054.1.75358 WP_000989054.1.76817 WP_000989054.1.79293 WP_000989054.1.82832 WP_000989054.1.8290 WP_000989054.1.84323 WP_000989054.1.84520 WP_000989054.1.84599 WP_000989054.1.85012 WP_000989054.1.85187 WP_000989054.1.86789 WP_000989054.1.87416 WP_000989054.1.89263 WP_000989054.1.89564 WP_000989054.1.93582 WP_000989054.1.94270 WP_000989054.1.99044 WP_000989054.1.99558 WP_000989054.1.99908 gi|163942892|ref|YP_001647776.1| 315730.BcerKBAB4_5002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]