SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163942895|ref|YP_001647779.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163942895|ref|YP_001647779.1|
Domain Number 1 Region: 2-100
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 2.35e-37
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|163942895|ref|YP_001647779.1|
Sequence length 105
Comment phosphotransferase system PTS lactose/cellobiose-specific IIA subunit [Bacillus weihenstephanensis KBAB4]
Sequence
MDTIETKAFHLILHGGNARSCSMEAIDCAKRGEFQEAEAKLQEALNELQEAHRLQTELIQ
KEAAGEKTEVTLLMVHAQDHLMNAITVKELASEFVELYRKMSVDE
Download sequence
Identical sequences A0A084IWH7 A0A150CGF3 A0A1I6BEY7 A9VR55 C2Q3F4 C2SSR3 J7T7T6 J7Z618 J8HK90 J8J119 J8NJ32 J8PDJ6 J8PZ95 J9BFD2 R8EFT8 W4DVR4
WP_002016162.1.100646 WP_002016162.1.100649 WP_002016162.1.11324 WP_002016162.1.20051 WP_002016162.1.20881 WP_002016162.1.21695 WP_002016162.1.27729 WP_002016162.1.27732 WP_002016162.1.28299 WP_002016162.1.2902 WP_002016162.1.2904 WP_002016162.1.30061 WP_002016162.1.31050 WP_002016162.1.35095 WP_002016162.1.36226 WP_002016162.1.37635 WP_002016162.1.37801 WP_002016162.1.38645 WP_002016162.1.39255 WP_002016162.1.39896 WP_002016162.1.4354 WP_002016162.1.4496 WP_002016162.1.46157 WP_002016162.1.47674 WP_002016162.1.47957 WP_002016162.1.50411 WP_002016162.1.52845 WP_002016162.1.54007 WP_002016162.1.57105 WP_002016162.1.63476 WP_002016162.1.6426 WP_002016162.1.68186 WP_002016162.1.72867 WP_002016162.1.75292 WP_002016162.1.79293 WP_002016162.1.82832 WP_002016162.1.8290 WP_002016162.1.85012 WP_002016162.1.85187 WP_002016162.1.87416 WP_002016162.1.93582 WP_002016162.1.99558 WP_002016162.1.99908 gi|163942895|ref|YP_001647779.1| 315730.BcerKBAB4_5005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]