SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163943038|ref|YP_001647922.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163943038|ref|YP_001647922.1|
Domain Number 1 Region: 5-64
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000000000535
Family SinR domain-like 0.02
Further Details:      
 
Domain Number 2 Region: 157-250
Classification Level Classification E-value
Superfamily TPR-like 0.000000000799
Family Tetratricopeptide repeat (TPR) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|163943038|ref|YP_001647922.1|
Sequence length 287
Comment XRE family transcriptional regulator [Bacillus weihenstephanensis KBAB4]
Sequence
MHAEKLGSEIKKIRVMRGLTQKQLSDNVCHQSEVSRIESGAVYPSMDILQGIAAKLQVPI
IHFYEVLIYSDIERKKLFKDRIQMLSKKKQYAEIYSIVSNELKKEKFHPEFNQFLLWYYY
LSAYVLQKINFEYCILELKKIVHQSYGGIDVFQNLYIENSIASICAENNQLDRAITSFRA
ILERLESLHNNEAFTVKVRYNYAKALYLSDQFEEALYQVNEAIEASRYMGSMELIGQLYY
QKGECLEKLEYSSDDIKEVYKKASFFFDLLDLHSYKETLLKKKKYLN
Download sequence
Identical sequences A0A1S9VAW4 A0A243AJH0 A9VSE8 J7Z5H4 J8J3M1 Q2PUL4 R8MGS8 W4DTF8
315730.BcerKBAB4_5148 gi|163943038|ref|YP_001647922.1| WP_002130082.1.27732 WP_002130082.1.35095 WP_002130082.1.36226 WP_002130082.1.37635 WP_002130082.1.39255 WP_002130082.1.4354 WP_002130082.1.60236 WP_002130082.1.6426 WP_002130082.1.64566 WP_002130082.1.65665 WP_002130082.1.72867 WP_002130082.1.75292 WP_002130082.1.82832 WP_002130082.1.85012 WP_002130082.1.85187 WP_002130082.1.87416 WP_002130082.1.99558 WP_002130082.1.99908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]