SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163943055|ref|YP_001647939.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163943055|ref|YP_001647939.1|
Domain Number 1 Region: 1-121
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 2.56e-26
Family DNA-binding N-terminal domain of transcription activators 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|163943055|ref|YP_001647939.1|
Sequence length 135
Comment MerR family transcriptional regulator [Bacillus weihenstephanensis KBAB4]
Sequence
MYKIDEVTKQVGLTKRTLRYYEEIGLIHPPERSEGNIRLYTDEDIARIKRIVEAKEVLGI
TLQEMQHFLSLKERMEQRRNSENPRDREVIQEIKEMLEKQVQTLDEKMEQMQRVKAELED
SLSRAVTFLENTKGE
Download sequence
Identical sequences A0A084IYM3 A0A0J6L2D8 A0A150CH50 A0A1I6C892 A0A243A6U9 A9VSG5 C2Q3V5 C2Y280 J7VUL8 J8CJF8 J8ECM2 J8J0K5 J8K3Y4 J8PD00 J8PU77 J9BH52 R8CND2 R8CU32 R8HGK3 R8MG95 W4DUK5
315730.BcerKBAB4_5166 WP_002016353.1.100231 WP_002016353.1.10033 WP_002016353.1.100646 WP_002016353.1.100649 WP_002016353.1.11324 WP_002016353.1.14117 WP_002016353.1.17940 WP_002016353.1.20051 WP_002016353.1.20881 WP_002016353.1.21695 WP_002016353.1.27729 WP_002016353.1.27732 WP_002016353.1.28299 WP_002016353.1.2904 WP_002016353.1.31050 WP_002016353.1.36226 WP_002016353.1.37635 WP_002016353.1.37801 WP_002016353.1.38645 WP_002016353.1.39317 WP_002016353.1.39896 WP_002016353.1.4354 WP_002016353.1.46157 WP_002016353.1.47674 WP_002016353.1.47957 WP_002016353.1.50411 WP_002016353.1.52845 WP_002016353.1.54007 WP_002016353.1.59016 WP_002016353.1.60236 WP_002016353.1.6426 WP_002016353.1.64566 WP_002016353.1.68186 WP_002016353.1.68668 WP_002016353.1.72867 WP_002016353.1.75292 WP_002016353.1.76817 WP_002016353.1.79293 WP_002016353.1.82832 WP_002016353.1.8290 WP_002016353.1.85012 WP_002016353.1.85187 WP_002016353.1.86789 WP_002016353.1.87416 WP_002016353.1.93582 WP_002016353.1.99558 WP_002016353.1.99908 gi|163943055|ref|YP_001647939.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]