SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163943084|ref|YP_001647968.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163943084|ref|YP_001647968.1|
Domain Number 1 Region: 61-325
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.76e-54
Family L-arabinose binding protein-like 0.0000221
Further Details:      
 
Domain Number 2 Region: 1-60
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 3.02e-17
Family GalR/LacI-like bacterial regulator 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|163943084|ref|YP_001647968.1|
Sequence length 325
Comment LacI family transcriptional regulator [Bacillus weihenstephanensis KBAB4]
Sequence
MTNIRKIAELAGVSVSTVSRVLNNHPYVNEQKRKEILAIIEELNYTQNVNAIHLVKGKTN
VIGVLLPHVNDQYYSAIIGGISKETAKNNYNMMLCQTNYSEEKELEILHMLKMKKLDGVI
ICSRTNSKEKLEEYTKFGPIVMCEEIDSNFISSVHIDYYKVFLRGMKSLIDAGHTRIGYC
IGRSNSINSQRRKKAYEDSLQQIVVTPLDAWKFKGCFTVEDGRNVVREWARMSVKPTAFL
VSCNHIAAGMVTEAKKQGIRIPEDITIIGCDDQEVANILGITTISHSSKNVGVKAFELLY
EKINDEEIDVKHVELLPDLVDRETT
Download sequence
Identical sequences A0A0B5S199 A0A150CGY3 A0A1I6C7Z9 A9VTE0 J7W6Y2 J8CJX5 J8NJ49 J8PCX1 J8PU46 R8EHX5
315730.BcerKBAB4_5195 WP_002089844.1.10033 WP_002089844.1.100646 WP_002089844.1.20051 WP_002089844.1.20881 WP_002089844.1.21695 WP_002089844.1.27729 WP_002089844.1.2902 WP_002089844.1.2904 WP_002089844.1.37801 WP_002089844.1.38645 WP_002089844.1.46157 WP_002089844.1.47674 WP_002089844.1.47957 WP_002089844.1.52845 WP_002089844.1.54007 WP_002089844.1.63476 WP_002089844.1.68186 WP_002089844.1.8290 WP_002089844.1.85012 WP_002089844.1.99908 gi|163943084|ref|YP_001647968.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]