SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163943142|ref|YP_001648026.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163943142|ref|YP_001648026.1|
Domain Number 1 Region: 3-252
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 5.37e-46
Family YhfI-like 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|163943142|ref|YP_001648026.1|
Sequence length 264
Comment beta-lactamase domain-containing protein [Bacillus weihenstephanensis KBAB4]
Sequence
MSMHFSVLASGSTGNMLYVGTDEKKLLVDAGLSGKATEALFKQAELNINDISGILVTHEH
SDHIKGLGVLARKYDLPVYANEKTWNAMEHLIGNIPTDQKFIFSVGDVKTFGDIEVESFG
VSHDAAEPMFYAFHNNNRKLALITDTGYVSDRMKGVIKGANAFVFESNHDVEMLRMGRYP
WSIKRRILSDVGHVCNEDAALAMADVITDETKHIYLAHLSLDNNMKELARMSVSQVLEEK
GFGVGESFEIHDTDQKMPTKIQYV
Download sequence
Identical sequences A0A109G5X4 A0A243A7C6 A9VTJ8 J8Y7N4 R8CNQ2 R8EHS7 R8PXI2
315730.BcerKBAB4_5255 WP_002138925.1.100479 WP_002138925.1.100646 WP_002138925.1.2902 WP_002138925.1.31050 WP_002138925.1.45835 WP_002138925.1.50411 WP_002138925.1.64566 WP_002138925.1.68668 WP_002138925.1.76817 WP_002138925.1.84520 WP_002138925.1.84599 WP_002138925.1.99908 gi|163943142|ref|YP_001648026.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]