SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163943157|ref|YP_001648041.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163943157|ref|YP_001648041.1|
Domain Number 1 Region: 178-276
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 5.1e-17
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.006
Further Details:      
 
Domain Number 2 Region: 112-173
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 9.15e-16
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.0016
Further Details:      
 
Domain Number 3 Region: 22-110
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), transmembrane region 0.0000000000000392
Family Mechanosensitive channel protein MscS (YggB), transmembrane region 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|163943157|ref|YP_001648041.1|
Sequence length 285
Comment MscS mechanosensitive ion channel [Bacillus weihenstephanensis KBAB4]
Sequence
MDLALKWFESIDWTNIGVKSLKIIVILILGAIVVRVARAIVRNAFRMGSRSPIQISERRT
VTVAKLLENIVAYVVMFIMLIAILGVFDINASGLLAGAGVIGLAVGFGAQSLVKDVITGL
FILLEDQFSVGDYVRIGQFEGTVLEIGLRTTKMKSWTGEIHIIPNGSIVQVTNFSVSNSV
AFVDVSISYESDIVRAEQVIEDLLVELPGKYEKMVTTPQLLGVQTLAASEVVLRVIAEVE
PMQHAVIARALRKEIKNRLDLHGIEIPYPRMVLYSREELVSEKAI
Download sequence
Identical sequences A0A0A0WRR9 A0A150BWI8 A9VTL3 C2Q453 C2STI2 J8CJR8 J8H637 J8J367 R8EHR5 R8HH08 R8MHJ5
WP_002016466.1.100646 WP_002016466.1.100649 WP_002016466.1.11324 WP_002016466.1.17940 WP_002016466.1.28299 WP_002016466.1.2902 WP_002016466.1.30061 WP_002016466.1.38645 WP_002016466.1.39896 WP_002016466.1.4354 WP_002016466.1.4496 WP_002016466.1.45835 WP_002016466.1.47957 WP_002016466.1.54007 WP_002016466.1.57105 WP_002016466.1.60236 WP_002016466.1.63476 WP_002016466.1.6426 WP_002016466.1.72867 WP_002016466.1.79293 WP_002016466.1.85012 WP_002016466.1.85187 WP_002016466.1.86789 WP_002016466.1.87416 WP_002016466.1.93582 WP_002016466.1.99908 gi|163943157|ref|YP_001648041.1| 315730.BcerKBAB4_5270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]