SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163943266|ref|YP_001642496.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163943266|ref|YP_001642496.1|
Domain Number 1 Region: 6-514
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 2.38e-124
Family Alkylsulfatase-like 0.00000000567
Further Details:      
 
Weak hits

Sequence:  gi|163943266|ref|YP_001642496.1|
Domain Number - Region: 524-618
Classification Level Classification E-value
Superfamily SCP-like 0.000506
Family Alkylsulfatase C-terminal domain-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|163943266|ref|YP_001642496.1|
Sequence length 657
Comment beta-lactamase domain-containing protein [Bacillus weihenstephanensis KBAB4]
Sequence
MKITQDPKDATNCTTLFNKQVAEDLNINSETEYALAIKNLVEPCEELVIMEDNKIIWSQK
AYQFLEKDEWSSTVNPSLWCNGKNNHVSGLFKVTEEIYQVRGFDMANMTMVLTPQKTWVM
LDTLMSTECTIAALNFADTYFTKNNLPKLIGNIRAIIMSHSHVDHFGGVNGIFTYEEQNP
DIPIYAPKGFTEHAVSENIYAGNAMARRAAYQYGSFLDAGKKGSISIGIGQTQSKGTISF
RLPTHEITENQSIVIDDLKLTFQLTPGAEAPAEMNTHFPKYRALWLAENCSGTLHNLYTL
RGAQVRDGNAWGKYLLESISLFADETDVTFQAHNWPHWNTDDSPNMVREHITVTAAAYKF
INDQTLLYINQGYTSTEIADKIQLPTDLAKYWYIRPYYGTPKHNAKAVYQKYMGWYDANP
ANLDPLPNVKRAEKLIDYMGGSDAVIEKSLIDFENGNYQFVADIMSTLVFADPNNQKARF
LAADALEQLGYQSESGIWRNAYLSGAYELRNGTVTDPTKYVSGAEITEYMTGEMILDYLG
ILIDGDRCSHFSLEFNLIISDDIDLTEGSSEYHMREYILKLYQGTVLYFKDTSSSELPTV
TMTRQQLLSLTAGSTPEKAKEIAESISDDPKVIDALVNFMSYITQLSEYRHFNIIEP
Download sequence
Identical sequences A9VV89
gi|163943266|ref|YP_001642496.1|NC_010180 315730.BcerKBAB4_5539 WP_012259842.1.99908 gi|163943266|ref|YP_001642496.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]