SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163943279|ref|YP_001642509.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163943279|ref|YP_001642509.1|
Domain Number 1 Region: 24-367
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.63e-43
Family Pectin lyase 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|163943279|ref|YP_001642509.1|
Sequence length 425
Comment carbohydrate-binding and sugar hydrolysis protein [Bacillus weihenstephanensis KBAB4]
Sequence
MKKICSPLLLLLVFCFPGVSIHAESTLQSKIDAASPYETITLENRAYNETIKISKPLTIQ
GDKNTKIISCGKDPVITINKENIILKDLKIEQCNDNTDQPAIFVEGDKHYISGLEVHTSY
IGIKLENARDIKIENSMIVGQRRANGIDLWQSNRNLIENIKIQNARDGIYLEQSDNNTIK
ENTIWQSRYGIHLMYSDRTVVEKNISKENTTGAMIMGTKETSVVGNRFIYNKSNVHAQGL
LLYDATKTKVLQNEIANNRVGVYVEKADHNTIMDNSISNNFIGLQFKDASANEFTQNVMM
GNVNESQATQSRENNIYNNYWDASLKVDADGSGTSNIPYKADAYFLLLTQDIPEYQLFFQ
SPGMRILQSFIKIPDQSLLLDKEPSMRPKGVPQKGEGMAFQSNILIVSVSMLLMGSILFI
LGRKN
Download sequence
Identical sequences A9VUG3
gi|163943279|ref|YP_001642509.1| gi|163943279|ref|YP_001642509.1|NC_010180 WP_012259849.1.99908 315730.BcerKBAB4_5553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]