SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163943321|ref|YP_001642551.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163943321|ref|YP_001642551.1|
Domain Number 1 Region: 71-123
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0000103
Family DNA-binding N-terminal domain of transcription activators 0.056
Further Details:      
 
Weak hits

Sequence:  gi|163943321|ref|YP_001642551.1|
Domain Number - Region: 13-63
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.016
Family DNA-binding N-terminal domain of transcription activators 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|163943321|ref|YP_001642551.1|
Sequence length 333
Comment MerR family transcriptional regulator [Bacillus weihenstephanensis KBAB4]
Sequence
MTQDLLFITKPTVTTKEAAGLLGVTVQTILQKEKDGLIECVYKDNWKQFGSKIFYLEDIE
RIKNIEEVEGYSTKEAAEILNVATSTVFTYIKSGKLPASKIEKRGKEVYIIDKDDLETFQ
LTYEKTTSKERKTFITKIQEEDIYLYQLLTHQHTGKTARVIEINGADGKILTEDEEIFPL
STYKEHDYSFEPFHKQAVITKRGYLSFSLKKPQLFNSIIYNLINLFYKELGVTNMRLSIS
SDTIKLEIKPFVLQVDPLQFQEEIKYLHSHMKSGTILPHVEGIYFKSNVEPLTFHADHEF
KQKVVQMAADAGMGQEEFLLQAVKFYITNLEKA
Download sequence
Identical sequences A9VUK5 J8BN25
WP_002144061.1.85012 WP_002144061.1.99908 315730.BcerKBAB4_5607 gi|163943321|ref|YP_001642551.1| gi|163943321|ref|YP_001642551.1|NC_010180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]