SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163943346|ref|YP_001642576.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163943346|ref|YP_001642576.1|
Domain Number 1 Region: 5-57
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000000617
Family SinR domain-like 0.054
Further Details:      
 
Weak hits

Sequence:  gi|163943346|ref|YP_001642576.1|
Domain Number - Region: 20-123
Classification Level Classification E-value
Superfamily DNA-binding protein Tfx 0.0017
Family DNA-binding protein Tfx 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|163943346|ref|YP_001642576.1|
Sequence length 152
Comment XRE family transcriptional regulator [Bacillus weihenstephanensis KBAB4]
Sequence
MDKQEFIQLVNKKLKLIRIENDLSQDKMSEVIGLSKKTLVEIEKGRRSLTWTGAVCVVTL
FEDSDIIQMTFGDDINEIIKTIAFTHYNNSSSKTLGGKLWWRQIRELNGYKIQQNILSQH
YRILNKENHRICSSFELDEIEKRFIEVTKSLQ
Download sequence
Identical sequences A0A2C1L3J5 A9VUN0 J8C8A5 R8QWT4
gi|163943346|ref|YP_001642576.1| 315730.BcerKBAB4_5634 WP_002144462.1.100479 WP_002144462.1.85012 WP_002144462.1.99908 gi|163943346|ref|YP_001642576.1|NC_010180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]