SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163943355|ref|YP_001642585.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|163943355|ref|YP_001642585.1|
Domain Number - Region: 504-557
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00138
Family GalR/LacI-like bacterial regulator 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|163943355|ref|YP_001642585.1|
Sequence length 565
Comment RpiR family transcriptional regulator [Bacillus weihenstephanensis KBAB4]
Sequence
MEKVLVLFSDALLLAAPMYEKNTQLWGKWNRYYEEVQGNHDKVVTSANISPSFSALVSWL
GQKQEQGISLLHIYANLDKYKIEIRNVLDKIIEQEFGGTSEEVETAIISNTTDEKLKEHS
IDLQEDYYPVSNDAVYYQLRDGIAKNHFEEDEVGAVSVLPLETKNTSGVAQLSSHKDEDL
RLVNTNEAERWSILVDGVISNMDDLTADCLDTITIQWLNQAKSPDDFIDFSYENVLDMCN
IPKASANGIEYYRAEDKIKIAQRIAALASIFIYLNDDNEVVVLNDRAETGEQFEMKREII
KRLFVLDSVVLWRDKNTNDYVGIESCRIKPGSFLSMYLYGSSSTTALLSKKALEYNSYRH
KFHKRLIRYLSWQWRIRQQYSNLKRPYSIDGEKGLLSVMGINIAKGRPHRIREQLENVLI
DLEKEKVISHWEYAEEIDESRIGERNWFKNYYSKLGIIILPPKELMDNIGSLAKKKVIDT
PDKQENNVIINTIAHSTVSTEELIREKIMHQHMHQNRTMREIADELGLSPATLSRFCNKK
MKRISNSVNDKLTKWYERQMIIESM
Download sequence
Identical sequences A9VUN9
gi|163943355|ref|YP_001642585.1| gi|163943355|ref|YP_001642585.1|NC_010180 WP_012259892.1.99908 315730.BcerKBAB4_5645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]