SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|163943365|ref|YP_001642595.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163943365|ref|YP_001642595.1|
Domain Number 1 Region: 71-191
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0000000379
Family Retroviral integrase, catalytic domain 0.033
Further Details:      
 
Weak hits

Sequence:  gi|163943365|ref|YP_001642595.1|
Domain Number - Region: 8-64
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0591
Family FIS-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|163943365|ref|YP_001642595.1|
Sequence length 235
Comment integrase catalytic region [Bacillus weihenstephanensis KBAB4]
Sequence
MEKENLFKWKHYQPELILLTVRWYLRYNLSFRNLVEMMEERGLSIAHTTIMRWVHQYGPQ
LEEKVRHHLKSTNDSWRVDETYIKVKGQWMYLYRAVDSKGNTIDFHLSKSRDKQAAKCFF
KKALAFSYVSKPRVITVDKNPAYPVAIQALKEEKHMPEGIKLRQVRYLNNIVEQDHRFIK
KRVRSMLGFKSFGTATSILAGVEAMHMIKKEQIDLRDQSVQNQKEFIHQLFGLTA
Download sequence
Identical sequences A9VUP9
WP_012259899.1.99908 315730.BcerKBAB4_5656 gi|163943365|ref|YP_001642595.1| gi|163943365|ref|YP_001642595.1|NC_010180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]