SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163943366|ref|YP_001642596.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163943366|ref|YP_001642596.1|
Domain Number 1 Region: 12-61
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000906
Family GalR/LacI-like bacterial regulator 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|163943366|ref|YP_001642596.1|
Sequence length 76
Comment XRE family transcriptional regulator [Bacillus weihenstephanensis KBAB4]
Sequence
MFWKFGGKNRTKLGDFLDRNGFTQNDLEKTAKLSRPTVSKACNDKEYIPSPTVMKKILKV
IRQIKPNVKSTDFWDM
Download sequence
Identical sequences A0A0G8C5C9 A0A109G2G3 A9VUQ0 J7ZXP5 J8ZP35 J9BPP2 R8NIM1 R8NT08
WP_002150963.1.100215 WP_002150963.1.100621 WP_002150963.1.10775 WP_002150963.1.22507 WP_002150963.1.31050 WP_002150963.1.37649 WP_002150963.1.50411 WP_002150963.1.53672 WP_002150963.1.60236 WP_002150963.1.89263 WP_002150963.1.89564 WP_002150963.1.89704 WP_002150963.1.92620 WP_002150963.1.99044 WP_002150963.1.99908 gi|163943366|ref|YP_001642596.1| 315730.BcerKBAB4_5657 gi|163943366|ref|YP_001642596.1|NC_010180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]