SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163943394|ref|YP_001642624.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|163943394|ref|YP_001642624.1|
Domain Number - Region: 3-43
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0159
Family SinR domain-like 0.023
Further Details:      
 
Domain Number - Region: 113-191
Classification Level Classification E-value
Superfamily Respiratory nitrate reductase 1 gamma chain 0.0549
Family Respiratory nitrate reductase 1 gamma chain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|163943394|ref|YP_001642624.1|
Sequence length 203
Comment hypothetical protein BcerKBAB4_5688 [Bacillus weihenstephanensis KBAB4]
Sequence
MVDIVNATRQTTSLIESNKSSPSLKFYICIDGNFYSSLDKLFWRNFKMEKLKKWFSLSTH
KDERIQQIEMKIWAQSGIVVLLLAFIDVIIRGAYLHRPFLEWIASLAIILCYMIFFFIKS
ILTGVYETDINNKEQLNEKLKEKMSNTFIFCFVAIGATTYKYYFPEDFGGWLAAIAKFII
LFVFLFGIQYLITVIAWKRSNKI
Download sequence
Identical sequences A9VUS8
gi|163943394|ref|YP_001642624.1|NC_010180 315730.BcerKBAB4_5688 gi|163943394|ref|YP_001642624.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]