SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163943401|ref|YP_001642631.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163943401|ref|YP_001642631.1|
Domain Number 1 Region: 2-65
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 3.1e-18
Family SinR domain-like 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|163943401|ref|YP_001642631.1|
Sequence length 66
Comment XRE family transcriptional regulator [Bacillus weihenstephanensis KBAB4]
Sequence
MLNNRIVVCRAEKGWTQQDLGERVGASRQTIASMERNKYNPSLILAFKIAQAFGKPLEEV
FEFKEE
Download sequence
Identical sequences A0A150DBY2 A0A1W2GXP9 A0A246PNC1 A0A2B4FNA0 A0A2B5EEQ7 A0A2H2VMN3 A9VUT5 C3HBH7 J8CCH5 J8KV99 J9BRD5 R8CLP7
gi|163943401|ref|YP_001642631.1| WP_000933886.1.101140 WP_000933886.1.13498 WP_000933886.1.14174 WP_000933886.1.4447 WP_000933886.1.50411 WP_000933886.1.54116 WP_000933886.1.58586 WP_000933886.1.68668 WP_000933886.1.74863 WP_000933886.1.7544 WP_000933886.1.85012 WP_000933886.1.87777 WP_000933886.1.87873 WP_000933886.1.99908 gi|163943401|ref|YP_001642631.1|NC_010180 315730.BcerKBAB4_5696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]