SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163943473|ref|YP_001642702.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|163943473|ref|YP_001642702.1|
Domain Number - Region: 8-36
Classification Level Classification E-value
Superfamily C-terminal domain of transcriptional repressors 0.0504
Family FeoA-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|163943473|ref|YP_001642702.1|
Sequence length 79
Comment hypothetical protein BcerKBAB4_5372 [Bacillus weihenstephanensis KBAB4]
Sequence
MGLKDETTGEEELLNKLMNIGIYKDYVVSIVGVTYLYLLLRNMIQVSILSFSDMRLLKIN
RETLVSLQKVLLGILNCPS
Download sequence
Identical sequences A9VVB2
gi|163943473|ref|YP_001642702.1|NC_010181 gi|163943473|ref|YP_001642702.1| 315730.BcerKBAB4_5372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]