SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163943485|ref|YP_001642714.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163943485|ref|YP_001642714.1|
Domain Number 1 Region: 8-120
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0000000061
Family DNA-binding N-terminal domain of transcription activators 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|163943485|ref|YP_001642714.1|
Sequence length 213
Comment putative DNA-binding protein [Bacillus weihenstephanensis KBAB4]
Sequence
MSETEIIYTSSEVYSRLGVSSSTLRKYSDVLEREGYDVRKNSRGRREYTEFDVVLIEKLV
ELSKQDGMTLEKSAKMIANQFGIGNKKEESQGSDPVPYQMQYQFQQQYSAMIEEINKVQQ
ANLLEMEKRLGDRIDQKNKLIEEDIKERNKLIKEDMKDRKEREERIEKRLELRDDNLMKM
VREIQDAKRTIVSVQEEIAAARSKKNSWWMFWK
Download sequence
Identical sequences A9VVC4 J8C9F1
315730.BcerKBAB4_5387 gi|163943485|ref|YP_001642714.1| gi|163943485|ref|YP_001642714.1|NC_010181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]