SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163938482|ref|YP_001643366.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163938482|ref|YP_001643366.1|
Domain Number 1 Region: 35-166
Classification Level Classification E-value
Superfamily Sensory domain-like 2.67e-42
Family Sensory domain of two-component sensor kinase 0.00014
Further Details:      
 
Domain Number 2 Region: 384-526
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 9.82e-23
Family Histidine kinase 0.0082
Further Details:      
 
Domain Number 3 Region: 321-405
Classification Level Classification E-value
Superfamily Sporulation response regulatory protein Spo0B 0.00000000562
Family Sporulation response regulatory protein Spo0B 0.0094
Further Details:      
 
Domain Number 4 Region: 206-307
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000152
Family Heme-binding PAS domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|163938482|ref|YP_001643366.1|
Sequence length 532
Comment signal transduction histidine kinase regulating citrate/malate metabolism [Bacillus weihenstephanensis KBAB4]
Sequence
MKKLKLQPRITLTISTLILVVLLLTSYLFYYILSETVEDQIGKRALHVAKTVAAIPEIQE
AFQKENPASIIQPIAEKIRIETDADFIVVGNKDGIRYAHPKRDKIGERMVGGDNEGVLLE
GESYVSKATGSLGPSLRGKVPIRNQDNEIIGVVSVGFSMDDIHGAIEVYGKRVFWITITG
LLIGIIGSVYLAKSIKRMMFGMEPEEISSLYEEHSTVIQSVREGIVVIDKNGMVSLVNQA
AYDILSLDKQQNIMGEFILDVIPNSSILDVLQTGEEQFDRQLNIKGQDVIANRLPIKVNH
KVTGVVSSLRLKSEMDQLTAELSQTRQYTEALRAQTHEYNNLLYTLSGLIQLESYEDALE
LIHKETAVYQEFVQFIMKRIQNPWLGGILIGFYNRARELKIDFMLDRESSLEELSPHIES
NYVVSILGNLITNAFEAIERNHEHNKKVRMFVTDIGEEILIEVEDSGQGVHDEIITSIFY
KGFSTKAGEKRGYGLAKVKELVEDLNGSIAIEKGDLGGALFIIALPKERGEL
Download sequence
Identical sequences A9VTP2
315730.BcerKBAB4_0472 gi|163938482|ref|YP_001643366.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]