SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163938815|ref|YP_001643699.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163938815|ref|YP_001643699.1|
Domain Number 1 Region: 394-524
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 7.86e-27
Family Histidine kinase 0.013
Further Details:      
 
Domain Number 2 Region: 42-172
Classification Level Classification E-value
Superfamily Sensory domain-like 3.1e-25
Family Sensory domain of two-component sensor kinase 0.0018
Further Details:      
 
Domain Number 3 Region: 324-368
Classification Level Classification E-value
Superfamily Sporulation response regulatory protein Spo0B 0.00000000157
Family Sporulation response regulatory protein Spo0B 0.0094
Further Details:      
 
Domain Number 4 Region: 218-309
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000166
Family Heme-binding PAS domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|163938815|ref|YP_001643699.1|
Sequence length 529
Comment signal transduction histidine kinase regulating citrate/malate metabolism [Bacillus weihenstephanensis KBAB4]
Sequence
MKKSRKVSLQTKILGLIITLILFVVLLLAGIFVYIQSVDTKRQVEQLALQTAKSLSFMPA
IKEAFQYNEHKSTIQSIAEQVREQAGADYVIIENRYGVMYSHSNSELIGTKSNNPYNYEA
LTFGGYYTLEGNGASGPALMAKAPIIVHNGDYDQVVGVVTVEFLIKGIESNILSRTKEII
LFSLAVLLVGIVGGILLARSIRKDTLGLEPNEIAALYRERSAILLSIKEGIIAIDQNGFI
TMMNTSAEEMLHVSDDYMQQHISKVLSEFNMERVLENDQEIAFQDKVFILNMTPILENNS
TVGVVCSFRDKTELQNLVNTISEVRKYSEDLRAQTHEFTNKLFVLSGLLQLGHYKEAIEF
IQQESNIHQSQNHILFHQIHDAKVQAILLGKLGTASEKKIDFHIEGDSALHPLPDHIKVS
HLITILGNIIDNAFDAVSERGEKNVSFFVTDIGHDIVFEVIDSGAGILAEKITNIFQKGF
STKGNDRGYGLANVKEMVDLLEGTIEIQNEKNGGAIFTIYLPKTLREST
Download sequence
Identical sequences A9VH76
WP_012260419.1.99908 315730.BcerKBAB4_0811 gi|163938815|ref|YP_001643699.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]