SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163940690|ref|YP_001645574.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163940690|ref|YP_001645574.1|
Domain Number 1 Region: 5-121
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000706
Family Sfri0576-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|163940690|ref|YP_001645574.1|
Sequence length 125
Comment hypothetical protein BcerKBAB4_2746 [Bacillus weihenstephanensis KBAB4]
Sequence
MSKQNISTTVSGDLIVTHLIGKINTADVYEWFNGFEQVCQQFISEGRKYKLLVDRKGYTP
DHFSVQKAWKDKFFNETILNHSKAIAFLLEEGEIMNYLQQSNTKESVKFFDDYEQALIWL
NEYPI
Download sequence
Identical sequences A0A0B5SD44 A0A150CBA7 A9VJD9
315730.BcerKBAB4_2746 gi|163940690|ref|YP_001645574.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]