SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|163940735|ref|YP_001645619.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163940735|ref|YP_001645619.1|
Domain Number 1 Region: 3-169
Classification Level Classification E-value
Superfamily Acid phosphatase/Vanadium-dependent haloperoxidase 1.16e-38
Family Haloperoxidase (bromoperoxidase) 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|163940735|ref|YP_001645619.1|
Sequence length 199
Comment PA-phosphatase like phosphoesterase [Bacillus weihenstephanensis KBAB4]
Sequence
MSFSQFNIDIFRAINDLGKQYSFLNSAMVFLAEYMVYIFGLIIIAYWFTGSRKSRMMVIQ
AMVAFVIAEVIGKIAGKFHLNYQPFAVLPDVNKLVDHAVDNSFPSDHTILFFSICFSFLL
VRKKTGWLWIILAFCVAISRIWVGVHYPFDVVIGALIGCVSALFSYWLVPEFSFIKQLLT
LYERVEKHVLPSKNKSKGF
Download sequence
Identical sequences A0A0B5S373 A0A1I6C4L4 A9VK36 J8IWU5 R8ERH3 R8MZC3 W4E8U6
315730.BcerKBAB4_2794 gi|163940735|ref|YP_001645619.1| WP_002127913.1.100646 WP_002127913.1.20051 WP_002127913.1.20881 WP_002127913.1.21695 WP_002127913.1.27729 WP_002127913.1.2902 WP_002127913.1.35095 WP_002127913.1.36226 WP_002127913.1.37635 WP_002127913.1.37801 WP_002127913.1.38645 WP_002127913.1.4354 WP_002127913.1.60236 WP_002127913.1.63476 WP_002127913.1.6426 WP_002127913.1.68186 WP_002127913.1.72867 WP_002127913.1.82832 WP_002127913.1.84520 WP_002127913.1.85187 WP_002127913.1.87416 WP_002127913.1.99558 WP_002127913.1.99908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]