SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163941686|ref|YP_001646570.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163941686|ref|YP_001646570.1|
Domain Number 1 Region: 527-838
Classification Level Classification E-value
Superfamily Aldolase 2.01e-86
Family HMGL-like 0.00000142
Further Details:      
 
Domain Number 2 Region: 89-335
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 4.95e-68
Family BC ATP-binding domain-like 0.00000257
Further Details:      
 
Domain Number 3 Region: 835-1012
Classification Level Classification E-value
Superfamily post-HMGL domain-like 7.45e-60
Family Conserved carboxylase domain 0.00035
Further Details:      
 
Domain Number 4 Region: 4-118
Classification Level Classification E-value
Superfamily PreATP-grasp domain 6.33e-44
Family BC N-terminal domain-like 0.0000633
Further Details:      
 
Domain Number 5 Region: 342-460
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 8.89e-38
Family BC C-terminal domain-like 0.0000474
Further Details:      
 
Domain Number 6 Region: 1072-1146
Classification Level Classification E-value
Superfamily Single hybrid motif 7.33e-23
Family Biotinyl/lipoyl-carrier proteins and domains 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|163941686|ref|YP_001646570.1|
Sequence length 1148
Comment pyruvate carboxylase [Bacillus weihenstephanensis KBAB4]
Sequence
MTKLQRIQKVLVANRGEIAIRVFRACSELGLNTVAIYSKEDSGSYHRYKADESYLVGEGK
KPIDAYLDIEGIIEIAKSNHVDAIHPGYGFLSENIQFAKRCEEEGIIFIGPKSKHLDMFG
DKVKARTQAQLAQIPIIPGSDGPVNSIEEVEEFAEKYDYPIIIKASLGGGGRGMRIVRAS
EELRESYNRAKSEAKAAFGNDEVYVEKFVEKPKHIEVQILADEEGNVVHLYERDCSVQRR
HQKVVEIAPSVSLSDDLRQRICDAAVKLTKNVNYLNAGTVEFLVKGDEFYFIEVNPRVQV
EHTITEMITGVDIVQSQILIADGHALHSKMVGVPKQEEVVVHGFAIQSRVTTEDPLNNFM
PDTGKIMAYRSGGGFGVRLDTGNSFQGAVITPYYDSLLVKVTTWALTFEQAAAKMERNLK
EFRIRGIKTNIPFLENVVKHKNFLSGEYDTSFIDASPELFLFPKRKDRGTKMLNYIGTVT
VNGFPGVGKKEKPIFPDARIPNVIHSEPMQNGTKQILDERGADGLVKWVQDQKRVLLTDT
TFRDAHQSLLATRVRTKDLHHIAEPTARMLPNLFSAEMWGGATFDVAYRFLKEDPWERLL
DLREKMPNVLFQMLLRSSNAVGYKNYPDNLIQKFVECSAQAGIDVFRIFDSLNWVEGMRV
AIDAVRDTGKIAEATMCYTGDIHDPLRSKYDLNYYKNLAKELEASGAHILGIKDMAGLLK
PNAAYDLVSALKETVSIPIHLHTHDTSGNGILTYTKAIEAGVDIVDVAVSSMAGQTSQPS
ANTLYYALGGNERQPDVNIDSLEKLSHYWEDVRKYYAPFESGMNAPHTEVYMHEMPGGQY
SNLQQQAKAVGLGDRFDEVKVMYRRVNDMFGDIVKVTPSSKVVGDMALFMVQNHLTEQDI
LERGHAMDFPGSVVEMFSGDLGQPYGGFPKELQKIILKGKEPLTVRPGELLEPVDFDALK
EELFHKLGREVTIFDVVAYALYPKVFMDYEKVAGIYGNVSVLDTPTFFYGMRLGEEIDVE
IEQGKTLMVKLVSIGEPQPDGNRVLYLEFNGQPREIVVKDENVKSTVAQRVKGNRENPNH
ISATMPGTVIKVVVKEGDEVKKGDSMAITEAMKMETTVQAPFSGKVKKVYVNDGDAIQTG
DLLIELDH
Download sequence
Identical sequences A0A1S9TF36 A9VUA8 R8D4B1
gi|163941686|ref|YP_001646570.1| WP_012261618.1.10033 WP_012261618.1.68668 WP_012261618.1.86789 WP_012261618.1.93582 WP_012261618.1.99908 315730.BcerKBAB4_3773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]