SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|156936797|ref|YP_001434593.1| from Ignicoccus hospitalis KIN4/I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156936797|ref|YP_001434593.1|
Domain Number 1 Region: 11-206
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 1.4e-54
Family FAD-linked oxidases, N-terminal domain 0.033
Further Details:      
 
Domain Number 2 Region: 181-431
Classification Level Classification E-value
Superfamily FAD-linked oxidases, C-terminal domain 1.8e-42
Family Vanillyl-alcohol oxidase-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|156936797|ref|YP_001434593.1|
Sequence length 433
Comment FAD linked oxidase domain-containing protein [Ignicoccus hospitalis KIN4/I]
Sequence
MACPPLDVLCIDDESLLRAYLTDASPLRGNLPQAVLFPSDAAEVAKVIRWANKEKVAVYP
YGGGSSLVGSPLPFDGIVVDTSLLLDLEVFEKDKLVLAGAGWRLSELNHVLRRYGLWFPV
DPGSVEWATVGGVVATNAGGIRAVKYGLTSDHVRALEFVTPVGEVVWSGAWAKKSSTWLR
VHQLLVGSEGTLGIVTKALLTLSRVPERREAVLLLFEEAEEMGEAVLDILELAPSALEFM
DPKTVRAVNSRTDMSLKMPEKYLLLVEFDDERSSEKTKLILDKYEGIKEDPETLWKYRKL
AGPSLTLVKGSRSDWDVAVPVSLLPEAIKFVYENARDWEVAVFGHAGDGNLHVNLLHPPG
EEWVRKAIEKAKEIICEMSKRYKATVSGEHGIGLLKLALLGCEVDEPALELWKAIKKALD
PNLILNPGKKIPL
Download sequence
Identical sequences A8A8D4
gi|156936797|ref|YP_001434593.1| WP_011998038.1.33635 453591.Igni_0002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]