SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|156936824|ref|YP_001434620.1| from Ignicoccus hospitalis KIN4/I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156936824|ref|YP_001434620.1|
Domain Number 1 Region: 3-92
Classification Level Classification E-value
Superfamily all-alpha NTP pyrophosphatases 5.23e-22
Family HisE-like (PRA-PH) 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|156936824|ref|YP_001434620.1|
Sequence length 102
Comment phosphoribosyl-ATP pyrophosphohydrolase [Ignicoccus hospitalis KIN4/I]
Sequence
MSDFLSELWLVIKKRIEEKPQGSYTAEIVKRGLPFAARKFGEESVELIVASLSEPRDSVI
YEAADVIYHLMVLLALRGVDWAEVIKELERRSRAKSGAGGNS
Download sequence
Identical sequences A8A8G1
WP_011998065.1.33635 gi|156936824|ref|YP_001434620.1| 453591.Igni_0029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]