SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156936887|ref|YP_001434683.1| from Ignicoccus hospitalis KIN4/I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156936887|ref|YP_001434683.1|
Domain Number 1 Region: 85-197
Classification Level Classification E-value
Superfamily PIN domain-like 0.00000000925
Family PIN domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|156936887|ref|YP_001434683.1|
Sequence length 204
Comment hypothetical protein Igni_0092 [Ignicoccus hospitalis KIN4/I]
Sequence
MIKFVIDTSAVTDPRLRQLFGVNELWEVVEKYLELMALAKLKLGFSFYTTPSVMKEIKGF
LERSMCPSEIISKLGVWILVKDVSQTEAKIPARVFLEYVAEVKRRLDKGLRVAEESTRRA
MEGGEIGEHIRNLREKYREATRKGLLDSVADLEAAILALELGAVLVTNDEGLCKLASKLG
VSCIDPLTFVKTIEEYLNLIKRHG
Download sequence
Identical sequences A8A8M4
453591.Igni_0092 gi|156936887|ref|YP_001434683.1| WP_011998128.1.33635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]