SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|156936895|ref|YP_001434691.1| from Ignicoccus hospitalis KIN4/I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156936895|ref|YP_001434691.1|
Domain Number 1 Region: 104-327
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 5.23e-59
Family Creatinase/aminopeptidase 0.00000426
Further Details:      
 
Domain Number 2 Region: 16-77
Classification Level Classification E-value
Superfamily Creatinase/prolidase N-terminal domain 0.00000000192
Family Creatinase/prolidase N-terminal domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|156936895|ref|YP_001434691.1|
Sequence length 341
Comment peptidase M24 [Ignicoccus hospitalis KIN4/I]
Sequence
MASSKRSYSRKRELFLDCTLILHPSNVRWLTGFDAGIVLMGKDEDYLIVPELEYERALEV
VDWLNVVKGPRGALWKKALELCNGPFFADLSYLNFRTAITLMTELGAGDASKTVRRARMS
KDEEELSRIKKALEIAERAFLETWKELEEGTTELAAAGALEAHMREFGAQEFAFPTIVAF
GPNSSKPHAVPGEAQLSFGSVALFDFGAVYGGFRSDITRTYVPDKEPYASWYHAVLEAVN
AALKALKPGARGKDVDAAAREVLAEYGFEKAFVHGLGHGVGADIHEPPFLSPSSEDVVSK
GAVVTVEPGVYFKGQGGVRVEQLVYVDYNPIVLNSTPVMWW
Download sequence
Identical sequences A8A8N2
gi|156936895|ref|YP_001434691.1| WP_011998136.1.33635 453591.Igni_0100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]