SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|156936966|ref|YP_001434762.1| from Ignicoccus hospitalis KIN4/I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156936966|ref|YP_001434762.1|
Domain Number 1 Region: 260-591
Classification Level Classification E-value
Superfamily SIS domain 5.75e-84
Family double-SIS domain 0.00000185
Further Details:      
 
Domain Number 2 Region: 2-232
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 2.92e-61
Family Class II glutamine amidotransferases 0.00000506
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|156936966|ref|YP_001434762.1|
Sequence length 592
Comment glutamine--fructose-6-phosphate transaminase [Ignicoccus hospitalis KIN4/I]
Sequence
MCGIAGIAAREEYYDDVLKELIRLLESLEYRGYDSAGIAVYDVDSKKIRVWKKKGKVADL
VKLLRSQLGDFKLKASVGIAHTRWATHGEPKDENAHPHIDCEGKVAVVHNGIISNYKELK
RELEARGHSFRSETDTEVFAHLFEEELKRKEPFEAFKAAVARLEGYYAIVAITSLEPHKV
FFARKESPLVVGRGPKGNYVSSDVVSLVGNCWEVSPLYDDDVGWMNDKEIYVERGGVRRR
LSFIKPTWSPVQAQKGSYEYFMLKEIHEQPQVVKETLISIASEWDKVEEVVNLLEGWAVV
VAAGTSYHAGLIFSYNVMKETGRYIPVIDASEAPHFSKLLKGTVVAISQSGETYDTLKAV
RIAKENGAKVVGVVNVVGSTLDREADVSLYTRAGPEIGVAATKTFLTQLSVLNALVARMV
GEGANRVREMANELSKITKESIEVSAGYAKGLADQLYTKRDMYVLGTGISYPVAMEGALK
IKEISYVHAEAYPAGEAKHGPIALAEPGFPVLLVWTPEDVEKLEVAEKEFESRGSEVYWV
APRGDVPIPEVDWKYVPFALTPPLQLLSYYMAVKKGLDPDKPRNLAKSVTVH
Download sequence
Identical sequences A8A8V3
453591.Igni_0171 gi|156936966|ref|YP_001434762.1| WP_011998207.1.33635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]