SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156936984|ref|YP_001434780.1| from Ignicoccus hospitalis KIN4/I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156936984|ref|YP_001434780.1|
Domain Number 1 Region: 4-74
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.000000000105
Family Single 4Fe-4S cluster ferredoxin 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|156936984|ref|YP_001434780.1|
Sequence length 79
Comment ferredoxin-like protein [Ignicoccus hospitalis KIN4/I]
Sequence
MAKYKVWIENEKCISDAVCAHLCPDVFEMNEEYKAVIVPQYRTGDNPAEGVIPEELKDCA
EQAAAACPVQIIHVEPLQE
Download sequence
Identical sequences A8A8X1
gi|156936984|ref|YP_001434780.1| 453591.Igni_0189 WP_011998225.1.33635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]