SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|156937175|ref|YP_001434971.1| from Ignicoccus hospitalis KIN4/I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156937175|ref|YP_001434971.1|
Domain Number 1 Region: 185-277
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.000000000000432
Family Multidrug resistance efflux transporter EmrE 0.015
Further Details:      
 
Domain Number 2 Region: 38-135
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.0000000017
Family Multidrug resistance efflux transporter EmrE 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|156937175|ref|YP_001434971.1|
Sequence length 285
Comment hypothetical protein Igni_0381 [Ignicoccus hospitalis KIN4/I]
Sequence
MIEALVPLIPQFLWATNFVVSKVVISKGLHAMTLTALRWAIAGALLYAYSRLKGLRVVLS
KELLLPSLTGITGFSALTYLGLTYAKASVVGLTMALIPIFTSVLAAAFLKERLTPLLIAS
VAAGSTGVTLLTLDSSGLSWLGALLGSLAALDWAVYTVASKKAMRELSPIESLTSNALMA
QPFNFLLALPFFSLAPMADPEVLAGLLYVSLVPGFLAYFLWLYSVNLVGAARAGVYINAL
PLLTLALASASLGEALSGPQLAGAALILLALALVTLDYLKRLSTS
Download sequence
Identical sequences A8A9G2
gi|156937175|ref|YP_001434971.1| 453591.Igni_0381 WP_011998416.1.33635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]