SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|156937270|ref|YP_001435066.1| from Ignicoccus hospitalis KIN4/I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156937270|ref|YP_001435066.1|
Domain Number 1 Region: 6-125,240-394
Classification Level Classification E-value
Superfamily Substrate-binding domain of HMG-CoA reductase 1.31e-84
Family Substrate-binding domain of HMG-CoA reductase 0.00000301
Further Details:      
 
Domain Number 2 Region: 128-242
Classification Level Classification E-value
Superfamily NAD-binding domain of HMG-CoA reductase 7.72e-47
Family NAD-binding domain of HMG-CoA reductase 0.0000773
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|156937270|ref|YP_001435066.1|
Sequence length 408
Comment 3-hydroxy-3-methylglutaryl-CoA reductase [Ignicoccus hospitalis KIN4/I]
Sequence
MDELEKYVEMLEKGELSLSKLDKVLNPNLAALVRRRFLEKRIGKLLPGIASTILDFEELV
GRNIENPIGAVQIPLGIAGPIKVNGDYAKGEFYVPLATHEGALVASVNRGMKAVTLSGGA
NVKVLKDGMARAPVFRVPDVATAQELVEWVKEHFNEIKEVAESTTRHGKLKEIQPFVMGN
NVWLRFVYFTGDAMGMNMATIATEKACEYIEENFGRAQCVALSGNMCVDKKPAHLNVLLG
RGKYVVAEALIKKEVLEGVLKTDARSVHEVNERKNWAGSAFAGSFSYNAHFANIIAAIFL
ATGQDAAQIVESSMGFTWTEVRGEDLYISVTLPSLEVGTVGGGTRLQTQREALEILGVAG
GGDPPGTNALKFAEIVGASVLAGELNLLAALAARQLARAHERLGRGKG
Download sequence
Identical sequences A8A9Q7
gi|156937270|ref|YP_001435066.1| 453591.Igni_0476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]