SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156937280|ref|YP_001435076.1| from Ignicoccus hospitalis KIN4/I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156937280|ref|YP_001435076.1|
Domain Number 1 Region: 68-134
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000000000225
Family EDF1-like 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|156937280|ref|YP_001435076.1|
Sequence length 157
Comment XRE family transcriptional regulator [Ignicoccus hospitalis KIN4/I]
Sequence
MKGNVLYCEMCGRPIYGKAYRVYIEGAEMVLCESCFRSVKAKVAPLPKKERKAAPKPKTK
KVVEYVVVEDYAERVRKARERLGLSRRELGMKVGEHETVIKRIELGRLEPDLELARKLER
VLGVELVKKVEYEESEAPKFQGPAELTLGDVAVLRKE
Download sequence
Identical sequences A8A9R7
WP_011998521.1.33635 453591.Igni_0486 gi|156937280|ref|YP_001435076.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]