SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|156937324|ref|YP_001435120.1| from Ignicoccus hospitalis KIN4/I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156937324|ref|YP_001435120.1|
Domain Number 1 Region: 4-354
Classification Level Classification E-value
Superfamily Chorismate synthase, AroC 3.27e-122
Family Chorismate synthase, AroC 0.000000254
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|156937324|ref|YP_001435120.1|
Sequence length 380
Comment chorismate synthase [Ignicoccus hospitalis KIN4/I]
Sequence
MGGNTIGKMFSVTTWGESHGKAIGAVIDGCPAGLPLSEEDLLVELSLRRPGRRFTTPRRE
PDVPEILSGVFNGKTTGMPISIIIRNRDVISSYYEKIKETPRPGHADLAYIKKYGYEHWD
YRGGGRASGRETAARVAAGAVAKKLLGCLGVVVSGYVVELGGVEFPSAEDAEESLRSRLS
PFRVLCCEEKAEEVLKEALERRDSVGGVVEAVAWNAPAGLGEPVFDKLKADLAKAMMSIP
ASVGFEVGWGFKLARLRGSEARDKIVSSAGEATVEGDKAGGMLGGISVGAPIRIRVAFKP
TSSIMIPEKTVNIHTLEETEVEVPGRHDPAIVLRAVSVVESMFAIVLVDHAIRAGLLNPV
RVEWGPHCQRVWELYADRVP
Download sequence
Identical sequences A8A9W1
gi|156937324|ref|YP_001435120.1| WP_011998565.1.33635 453591.Igni_0531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]