SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|156937335|ref|YP_001435131.1| from Ignicoccus hospitalis KIN4/I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156937335|ref|YP_001435131.1|
Domain Number 1 Region: 180-540
Classification Level Classification E-value
Superfamily HydB/Nqo4-like 8.37e-97
Family Nqo4-like 0.00000206
Further Details:      
 
Domain Number 2 Region: 10-185
Classification Level Classification E-value
Superfamily Nqo5-like 6.02e-33
Family Nqo5-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|156937335|ref|YP_001435131.1|
Sequence length 540
Comment NADH-ubiquinone oxidoreductase, chain 49kDa [Ignicoccus hospitalis KIN4/I]
Sequence
MNFVGEVERKEWSNALYVEVEPQYWYENAARLKDQGYLFPSMLTAVDWPAEKKVQVFFLV
HRIRDASSVVLSTKVDRENRELPSLSSLYPGVEWHENETYEMFGINFTGHPDYERWGRIR
KLLLSEDPRLFPKDRFPLLKDSGGYKDLPKVNWAEIEGTDQEREGLREDLTYVYVGPQHP
ATHGPVGFLLGLKGEIVEDVIPRLGYVHRGVEWIYEQKEYLKVIPLLDRQCYIDGIGWEW
PYVMALEEIMDVKVDRRAQLLRILAAELSRIQSHLLYIGSFAENVNHLTAFAWTVRDREV
FINLLEMLTGQRMTFNYLRPGGVAFDLPQGFKDVYEKVVARFHKHFEKLIETTLDNPTVA
MRAEGVAQVSAEDAIKYGWSGPNLRASGVAWDLRINKPYGGYDDGIDFEGAVGSVGDNLD
RMLVRFEEIRQSLKIIRQVLRELTERGQNELGTHLKRVPPFPRKPGIAYGYHDSPRGENG
ILLVANPSDPKWRTRPWRVHMRSPVFVHTMSLKYLGKGLLLQDFLAFYISLDTCVAEMDR
Download sequence
Identical sequences A8A9X2
453591.Igni_0542 WP_011998576.1.33635 gi|156937335|ref|YP_001435131.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]