SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|156937383|ref|YP_001435179.1| from Ignicoccus hospitalis KIN4/I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156937383|ref|YP_001435179.1|
Domain Number 1 Region: 92-190
Classification Level Classification E-value
Superfamily Ribosomal protein S3 C-terminal domain 3.4e-24
Family Ribosomal protein S3 C-terminal domain 0.001
Further Details:      
 
Domain Number 2 Region: 12-100
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 1.64e-22
Family Prokaryotic type KH domain (KH-domain type II) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|156937383|ref|YP_001435179.1|
Sequence length 241
Comment 30S ribosomal protein S3 [Ignicoccus hospitalis KIN4/I]
Sequence
MSVAKKNIKKYFLEQALTQVKVDEYLAYKFHSVGYSKVELQKTPMGTRVIIYAERSGAII
GRRGQTIKQITKVLEEWFGIPNPQVTVVKVEEPELDARVMAFRLANALQRGFHFRRAAYT
TLRRIMGAGAIGAQVKVSGKLRGERARFEKYIAGKVYKSGNQVVRLTDRAIAHVLLKVGV
EGVEVIISKKSEEERPDDEVRIKSPEEVNEIVQKIREEMQQTQPEAPTLEETVEQSGGET
Q
Download sequence
Identical sequences A8AA20
453591.Igni_0590 gi|156937383|ref|YP_001435179.1| WP_011998624.1.33635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]