SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|156937551|ref|YP_001435347.1| from Ignicoccus hospitalis KIN4/I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156937551|ref|YP_001435347.1|
Domain Number 1 Region: 3-169
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.34e-34
Family GHMP Kinase, N-terminal domain 0.00031
Further Details:      
 
Domain Number 2 Region: 182-320
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 2.08e-24
Family Mevalonate kinase 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|156937551|ref|YP_001435347.1|
Sequence length 321
Comment mevalonate kinase [Ignicoccus hospitalis KIN4/I]
Sequence
MSVSARAPTKVTLFGEHSVVYGKPAIVFSMPIYINVKLSLSDDLMVITGPVSLRSVDLVI
SKDKIEVGDLVRKQMEKYVSYVVEALQTIGVEGARVEIESPMPVGAGVGTSAAVTVGTIA
AACALKRCGLNKEGIAKLAWEVEKKVQGKASPMDTFASALGGVLWIEKEDSGWKIERLSV
DQLPLVVGIFEKRKTTAELVREVALKVQRSEIYKDIIELMGKIAREAREALIKGDLKELG
ELMKLNNAMLEALGLVTKEVSNAIHAAELAGAYGAKASGAGSGGAVVALAEDVKAVRAAL
LASGAKKVFIVENPSRGVELI
Download sequence
Identical sequences A8AAI8
WP_012122904.1.33635 gi|156937551|ref|YP_001435347.1| 453591.Igni_0758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]