SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156937571|ref|YP_001435367.1| from Ignicoccus hospitalis KIN4/I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156937571|ref|YP_001435367.1|
Domain Number 1 Region: 5-97
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 8.12e-29
Family Ribosomal proteins L24p and L21e 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|156937571|ref|YP_001435367.1|
Sequence length 99
Comment 50S ribosomal protein L21 [Ignicoccus hospitalis KIN4/I]
Sequence
MVKAPKGWRHRTRHIYRKRVREKGAVPPLSLVLIDYKPGDKVIIDPNPAIWSGLPHRRFC
GKVGEVVGKRGKAYLVKVRDGDVYKTIIVRPEHLRPFKQ
Download sequence
Identical sequences A8AAK8
gi|156937571|ref|YP_001435367.1| 453591.Igni_0778 WP_012122924.1.33635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]