SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|156937581|ref|YP_001435377.1| from Ignicoccus hospitalis KIN4/I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156937581|ref|YP_001435377.1|
Domain Number 1 Region: 3-199
Classification Level Classification E-value
Superfamily SIS domain 7.79e-42
Family mono-SIS domain 0.0000277
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|156937581|ref|YP_001435377.1|
Sequence length 201
Comment hexulose-6-phosphate isomerase [Ignicoccus hospitalis KIN4/I]
Sequence
MKYLLDTMREIATFIYFASKMLKEHQVEEFTNLLVKIYNTPNSKVLVMGAGRSGLVARAF
AMRLMHLGYNAYVLGDTIVPSVREGDVVIAISGSGSTKLVLAAAEAAKQVGATVVVLTSY
PNSPLGKLADVVVEIPGRTKLSKSQDYFSRQILGQHEPLAPLGTLFEITVQAFLDSLVVE
LMNRLGKSEEDLRMQHANIEL
Download sequence
Identical sequences A8AAL8
453591.Igni_0788 gi|156937581|ref|YP_001435377.1| WP_012122934.1.33635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]