SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|156937643|ref|YP_001435439.1| from Ignicoccus hospitalis KIN4/I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156937643|ref|YP_001435439.1|
Domain Number 1 Region: 3-184
Classification Level Classification E-value
Superfamily LigT-like 4.01e-45
Family 2'-5' RNA ligase LigT 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|156937643|ref|YP_001435439.1|
Sequence length 185
Comment 2'-5' RNA ligase [Ignicoccus hospitalis KIN4/I]
Sequence
MLRAFIAVDIEGELSEKLARLAESLKSTGADVKLVEKENFHITIRFLGNVPEESIDVIEK
IMRDAVREVKPHKLKLRGVGAFPSPERPRVVWVGVEGDEELRKIFERIERELRRLGFKPE
TKGFTAHVTLARVRSGRGREALVKWINDMKDVELGELEVKSIRLKKSTLTPRGPIYETLR
EVELA
Download sequence
Identical sequences A8AAT0
453591.Igni_0850 gi|156937643|ref|YP_001435439.1| WP_012122996.1.33635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]