SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|156937659|ref|YP_001435455.1| from Ignicoccus hospitalis KIN4/I

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|156937659|ref|YP_001435455.1|
Domain Number - Region: 8-57
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00785
Family Multidrug resistance efflux transporter EmrE 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|156937659|ref|YP_001435455.1|
Sequence length 104
Comment hypothetical protein Igni_0866 [Ignicoccus hospitalis KIN4/I]
Sequence
MKKNPSAERMIGPSPSGALCLVVEVLLFLWSLQWLPSSAAYALFGHPFLSALASFWLALH
NPVFALLVLVNVWRARRGRCWPLWLRTYCCAPGSVPAYLLLRER
Download sequence
Identical sequences A8AAU6
gi|156937659|ref|YP_001435455.1| 453591.Igni_0866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]