SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|156937673|ref|YP_001435469.1| from Ignicoccus hospitalis KIN4/I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156937673|ref|YP_001435469.1|
Domain Number 1 Region: 6-173
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 6.8e-68
Family Inorganic pyrophosphatase 0.000000525
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|156937673|ref|YP_001435469.1|
Sequence length 187
Comment inorganic diphosphatase [Ignicoccus hospitalis KIN4/I]
Sequence
MSLEKLGPGKDAPEVVNVVIEIPMGGYVKYEMDKDTGLIKVDRVLYTAMYYPFNYGFIPG
TLEEDGDPVDVLVLSYDPFYPGTYLKAKPVGVLLMEDEEGPDSKIIAVPVEKVDPRFKDI
KDVNDIPQIIKDKIKHFFEHYKELEPGKWVKIKDWLPKEEAYKKIKAAIDRYQQNKRSSA
LTSGQGQ
Download sequence
Identical sequences A8AAW0
gi|156937673|ref|YP_001435469.1| WP_012123026.1.33635 453591.Igni_0880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]