SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|156937716|ref|YP_001435512.1| from Ignicoccus hospitalis KIN4/I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156937716|ref|YP_001435512.1|
Domain Number 1 Region: 4-396
Classification Level Classification E-value
Superfamily ADC synthase 1.7e-118
Family ADC synthase 0.000000016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|156937716|ref|YP_001435512.1|
Sequence length 401
Comment anthranilate synthase, component I [Ignicoccus hospitalis KIN4/I]
Sequence
MEGPSLILESAAGGETKARLSLVAWEPEVDVIVKEGEDVREALRELRGGDADTGTLYKGG
PIGYVSYEAVEAWEGVKHKGANDMGWPWGEFVVPKKFVVYDHVLGHASLCGVNKDELGVG
EPSELKVFDERLDVPKDVFVKWVEEVRRLEEEGEAIQVVISKSYTYRYEGDLRRLYFELR
RINPSPYMFHLRMKSGEVLGSSPELLFRVERGRAETFPIAGTRPRGKDEWEDLRLEEDLK
SDPKERAEHLMLVDLARNDLGKVSRPGTVRVTNMMYVEKYSHVQHLVSKVESELDPLFGP
EDVLAATFPAGTVSGAPKPAAMEIIGNLETLRRGPYAGAVGFVSGGEAEFAITIRSFFAR
SGLLRAQAGAGIVYYSVPLKEWEETEHKLAALKRALAPFLL
Download sequence
Identical sequences A8AB03
gi|156937716|ref|YP_001435512.1| 453591.Igni_0925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]