SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156937757|ref|YP_001435553.1| from Ignicoccus hospitalis KIN4/I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156937757|ref|YP_001435553.1|
Domain Number 1 Region: 6-80
Classification Level Classification E-value
Superfamily Ribosomal proteins S24e, L23 and L15e 2.3e-28
Family L23p 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|156937757|ref|YP_001435553.1|
Sequence length 87
Comment 50S ribosomal protein L23 [Ignicoccus hospitalis KIN4/I]
Sequence
MRAPEDIIIRPLHTEKALMLMEKYNTLTFIVRRDATKPEIKYAVEKLYNVKVEKVNTLIT
PKNEKKAYVKLSPEYKATDIASRIGLI
Download sequence
Identical sequences A8AB44
gi|156937757|ref|YP_001435553.1| WP_012123110.1.33635 453591.Igni_0966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]