SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|156937974|ref|YP_001435770.1| from Ignicoccus hospitalis KIN4/I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156937974|ref|YP_001435770.1|
Domain Number 1 Region: 14-288
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 2.3e-47
Family ROO N-terminal domain-like 0.0000119
Further Details:      
 
Domain Number 2 Region: 261-409
Classification Level Classification E-value
Superfamily Flavoproteins 1.04e-25
Family Flavodoxin-related 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|156937974|ref|YP_001435770.1|
Sequence length 412
Comment beta-lactamase domain-containing protein [Ignicoccus hospitalis KIN4/I]
Sequence
MSRRRDELVMYHVAKVTEDLYVLRVDDRYTKYFEALWEIPEGITYNAYLLKTDEGDVLFD
AWKRQFSSHLMEALERVTSPDRLKYVVVHHMEPDHTGSLEDVLRWAPNAKVLGHPLAGRM
MNAYPKAKERFKPVKDGEVLEVGGKKLRFVHTPWLHWPETMMTWLEEEGVLLTCDAFGGY
GIPLSLFDDQCVKLEEMIREMRKYVVTVIGHYREWIDRNIAKLEKLGIKPNVVAPAHGLI
WRKNVDRVFQVYKDVGKSKPKENKVLLVYASMYGTVEKVARGVECELVREGMEVAVYGFN
DTSRPYISEILTDASDAEVVVFATPTYEVEAFPFLKFVAQELCWKVGNGKKAVLISSYGW
SSAAIEDLKKTLENCGYKSVAEVKYNAIGPTAITDEAVAEIAKKVVDAIKSS
Download sequence
Identical sequences A8ABR1
WP_012123327.1.33635 453591.Igni_1186 gi|156937974|ref|YP_001435770.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]