SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|156937977|ref|YP_001435773.1| from Ignicoccus hospitalis KIN4/I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156937977|ref|YP_001435773.1|
Domain Number 1 Region: 131-374
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.88e-36
Family D-glucarate dehydratase-like 0.0001
Further Details:      
 
Domain Number 2 Region: 15-129
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 0.000000000106
Family Enolase N-terminal domain-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|156937977|ref|YP_001435773.1|
Sequence length 377
Comment mandelate racemase/muconate lactonizing protein [Ignicoccus hospitalis KIN4/I]
Sequence
MDLLSWPVPEGITFRVKVIKMKMKIDFETSFGKAEGTRVITVAEAGGCKGFGEAPAEAEP
LYSGEFVDSVVAFAKLVIPKIKMVEDVNGLLKVLNSYRGNNFAKSMIEYSVLTLLSCLRK
ESLVKAVGGRKIKIPVQESIGIVKDEDELVAWAERALEWGARRLKVKIKPGWDVEPVRAL
KREFPGVPVLADANGAYDPLKDVHWEYLSKVASYADALEQPFPPHEVAFSAKLASSEGIE
VILDESLEEPERVAELAYLSEGVGAPLGVNLKPPRFGGLVKSVETVELIIENELPFFIGG
MLETAVGRSLNMTVASLARGNLEPSDFSPEDHLFERGLAKDPFEVKCGFVEVRDSPGLLF
EIDEDYLDSVTVSEVVL
Download sequence
Identical sequences A8ABR4
453591.Igni_1189 WP_012123330.1.33635 gi|156937977|ref|YP_001435773.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]