SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|156937995|ref|YP_001435791.1| from Ignicoccus hospitalis KIN4/I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156937995|ref|YP_001435791.1|
Domain Number 1 Region: 1-157
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 8.35e-31
Family GHMP Kinase, N-terminal domain 0.00034
Further Details:      
 
Domain Number 2 Region: 174-271
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.32e-18
Family Homoserine kinase 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|156937995|ref|YP_001435791.1|
Sequence length 301
Comment homoserine kinase [Ignicoccus hospitalis KIN4/I]
Sequence
MWVCARAPSSSANLGPGYDVLALAHDAYFDVVCVRPSEETRVVKVTGEWKVPLERNSALA
AAEEALKRLGGKGVEIWVHKGVPPGRGLGSSGASAAAAVKAVELLLGKSLSPEEAVMSAA
EGERLVSGAAHADNVAASYLGGLVAVTYDPFKVLKFEVAEVELYVVTPWHEVPEGKTGAA
RSVLPEEVKLRDAVKMVGGAAAVIKALTSGDEDLLAKAIEMDPVVTPARSKLIPCFEEVV
KAAKGGGAKGVTISGAGPSLLLVGGGAEEAKAAWERCGVKATYKKVKPARGSSAVPPPSL
G
Download sequence
Identical sequences A8ABT2
453591.Igni_1208 gi|156937995|ref|YP_001435791.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]